Primary Antibodies

View as table Download

Goat Polyclonal Antibody against Tafazzin

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HLKTQAEQLHNH, from the C Terminus of the protein sequence according to NP_000107.1; NP_851828.1; NP_851829.1; NP_851830.1.

Rabbit polyclonal anti-TAZ (tafazzin) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TAZ.

Rabbit Polyclonal Anti-TAZ Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAZ antibody is: synthetic peptide directed towards the C-terminal region of TAZ. Synthetic peptide located within the following region: PNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQ

Carrier-free (BSA/glycerol-free) TAZ mouse monoclonal antibody,clone OTI5A4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TAZ mouse monoclonal antibody,clone OTI1B3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TAZ mouse monoclonal antibody,clone OTI5A4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TAZ mouse monoclonal antibody,clone OTI5A4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TAZ mouse monoclonal antibody,clone OTI1B3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TAZ mouse monoclonal antibody,clone OTI1B3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated