Primary Antibodies

Jump to Filters
View as table Download
KCNA1 Rabbit Polyclonal Antibody
TA314119

USD 345.00

In Stock

Rabbit polyclonal anti-KCNA1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human KCNA1.
KCNA1 Rabbit Polyclonal Antibody
TA338385

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNA1 antibody: synthetic peptide directed towards the middle region of human KCNA1. Synthetic peptide located within the following region: ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC
KCNA1 Rabbit Polyclonal Antibody
TA321086

USD 345.00

In Stock

Anti-KCNA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 460-472 amino acids of Human potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
KCNA1 Rabbit Polyclonal Antibody
TA321087

USD 345.00

4 Weeks

Anti-KCNA1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 460-472 amino acids of Human potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)