KCNA1 Rabbit Polyclonal Antibody

CAT#: TA338385

Rabbit Polyclonal Anti-KCNA1 Antibody

Product Images

WB Suggested Anti-KCNA1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNA1 antibody: synthetic peptide directed towards the middle region of human KCNA1. Synthetic peptide located within the following region: ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: potassium voltage-gated channel subfamily A member 1
• Database Link:
  NP_000208
  Entrez Gene 3736 Human
  UniProt ID Q09470
• Background: This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). [provided by RefSeq, Jul 2008]
• Synonyms: AEMK; EA1; HBK1; HUK1; KV1.1; MBK1; MK1; RBK1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Horse: 86%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane