Rabbit Polyclonal Anti-ADCK3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADCK3 antibody is: synthetic peptide directed towards the C-terminal region of Human ADCK3. Synthetic peptide located within the following region: LVLCLRELFEFHFMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDL |
Rabbit Polyclonal Anti-CABC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CABC1 antibody: synthetic peptide directed towards the N terminal of human CABC1. Synthetic peptide located within the following region: FANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEKARQAKARPENKQHKQ |
Rabbit polyclonal anti-ADCK3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCK3. |
Carrier-free (BSA/glycerol-free) ADCK3 mouse monoclonal antibody,clone OTI2A7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ADCK3 mouse monoclonal antibody,clone OTI2A7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ADCK3 mouse monoclonal antibody,clone OTI2A7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
