ADCK3 (COQ8A) Rabbit Polyclonal Antibody

CAT#: TA346630

Rabbit Polyclonal Anti-CABC1 Antibody

Product Images

WB Suggested Anti-CABC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CABC1 antibody: synthetic peptide directed towards the N terminal of human CABC1. Synthetic peptide located within the following region: FANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEKARQAKARPENKQHKQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: aarF domain containing kinase 3
• Database Link:
  NP_064632
  Entrez Gene 56997 Human
  UniProt ID Q8NI60
• Background: This gene encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis. Alternatively spliced transcript variants have been found; however, their full-length nature has not been determined. [provided by RefSeq, Jul 2008]
• Synonyms: ARCA2; CABC1; COQ8; COQ10D4; SCAR9
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 90%

Reference Data

• Protein Families: Protein Kinase