Goat Polyclonal Anti-ENPP2 / AUTOTAXIN (aa698-712) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | internal region of NP_006200.3; NP_001035181.1, NP_001124335.1 (PDHLTSCVRPDVRVS) |
Goat Polyclonal Anti-ENPP2 / AUTOTAXIN (aa698-712) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | internal region of NP_006200.3; NP_001035181.1, NP_001124335.1 (PDHLTSCVRPDVRVS) |
Rabbit Polyclonal Anti-ENPP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENPP2 Antibody: synthetic peptide directed towards the N terminal of human ENPP2. Synthetic peptide located within the following region: YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA |