Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Rabbit polyclonal Anti-LDB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LDB1 antibody: synthetic peptide directed towards the C terminal of human LDB1. Synthetic peptide located within the following region: VVGEPTLMGGEFGDEDERLITRLENTQFDAANGIDDEDSFNNSPALGANS |
Rabbit polyclonal Anti-LDB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LDB1 antibody: synthetic peptide directed towards the middle region of human LDB1. Synthetic peptide located within the following region: EPTRQQPSKRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQVPD |
Germany
Japan
United Kingdom
China
