Primary Antibodies

Jump to Filters
View as table Download
MYL9 Rabbit Polyclonal Antibody
TA346605

USD 475.00

5 Days

Rabbit Polyclonal Anti-MYL9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYL9 antibody: synthetic peptide directed towards the middle region of human MYL9. Synthetic peptide located within the following region: FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF
MYL9 Rabbit Polyclonal Antibody
TA322531

USD 345.00

In Stock

Anti-MYL9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human myosin, light chain 9, regulatory
MYL9 Rabbit Polyclonal Antibody
TA322532

USD 345.00

In Stock

Anti-MYL9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human myosin, light chain 9, regulatory