MYL9 Rabbit Polyclonal Antibody

CAT#: TA346605

Rabbit Polyclonal Anti-MYL9 Antibody

Product Images

WB Suggested Anti-MYL9 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYL9 antibody: synthetic peptide directed towards the middle region of human MYL9. Synthetic peptide located within the following region: FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: myosin light chain 9
• Database Link:
  NP_006088
  Entrez Gene 10398 Human
  UniProt ID P24844
• Background: Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Synonyms: LC20; MLC-2C; MLC2; MRLC1; MYRL2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Zebrafish: 93%

Reference Data

• Protein Pathways: Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction, Vascular smooth muscle contraction