Primary Antibodies

Jump to Filters
View as table Download
Semaphorin 3B (SEMA3B) Rabbit Polyclonal Antibody
TA330905

USD 375.00

5 Days

Rabbit Polyclonal Anti-SEMA3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SEMA3B antibody is: synthetic peptide directed towards the middle region of Human SEMA3B. Synthetic peptide located within the following region: FRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETA
Semaphorin 3B (SEMA3B) Rabbit Polyclonal Antibody
TA381343

USD 220.00

3 Weeks

SEMA3B Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 569-748 of human SEMA3B (NP_001005914.1).
Modifications Unmodified