TNFRSF10C Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNFRSF10C |
TNFRSF10C Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNFRSF10C |
Rabbit Polyclonal DcR1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DcR1 antibody was raised against a peptide corresponding to amino acids in a extracellular domain (ED) of human DcR1 precursor. |
Rabbit Polyclonal DcR1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DcR1 antibody was raised against a peptide corresponding to amino acids in the extracellular domain of human DcR1 precursor. |
Rabbit Polyclonal Anti-TNFRSF10C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFRSF10C antibody: synthetic peptide directed towards the N terminal of human TNFRSF10C. Synthetic peptide located within the following region: MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKG |
TNFRSF10C rabbit polyclonal antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TNFRSF10C |
TNFRSF10C rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TNFRSF10C |