DcR1 (TNFRSF10C) Rabbit Polyclonal Antibody

CAT#: TA330335

Rabbit Polyclonal Anti-TNFRSF10C Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TNFRSF10C"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TNFRSF10C antibody: synthetic peptide directed towards the N terminal of human TNFRSF10C. Synthetic peptide located within the following region: MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 25 kDa
Gene Name tumor necrosis factor receptor superfamily member 10c
Background TNFRSF10C is the receptor for the cytotoxic ligand TRAIL. TNFRSF10C lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. TNFRSF10C may protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms CD263; DCR1; DCR1-TNFR; LIT; TRAIL-R3; TRAILR3; TRID
Note Immunogen sequence homology: Human: 100%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Apoptosis, Cytokine-cytokine receptor interaction, Natural killer cell mediated cytotoxicity

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.