Primary Antibodies

View as table Download

Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ASS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASS antibody: synthetic peptide directed towards the C terminal of human ASS. Synthetic peptide located within the following region: SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE

Rabbit Polyclonal Anti-ASS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASS antibody: synthetic peptide directed towards the N terminal of human ASS. Synthetic peptide located within the following region: YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF

Rabbit Polyclonal antibody to ASS1 (argininosuccinate synthetase 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 198 of ASS1 (Uniprot ID#P00966)

Goat Polyclonal Antibody against Argininosuccinate synthetase 1

Applications WB
Reactivities Human, Cow
Conjugation Unconjugated
Immunogen Peptide with sequence C-ENPKNQAPPGLYTKTQD, from the internal region of the protein sequence according to NP_000041.2 ; NP_446464.1.

Rabbit Polyclonal antibody to ASS1 (argininosuccinate synthetase 1)

Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 155 and 412 of ASS1 (Uniprot ID#P00966)

Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI8C4 (formerly 8C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI4G9 (formerly 4G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody, clone OTI14C1 (formerly 14C1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody,clone OTI3D1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody,clone OTI8H4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ASS1 mouse monoclonal antibody,clone OTI12G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody, clone OTI8C4 (formerly 8C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody, clone OTI8C4 (formerly 8C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody, clone OTI4G9 (formerly 4G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody, clone OTI4G9 (formerly 4G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody, clone OTI8A3 (formerly 8A3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody, clone OTI14C1 (formerly 14C1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody, clone OTI14C1 (formerly 14C1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody,clone OTI3D1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody,clone OTI3D1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody,clone OTI8H4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody,clone OTI8H4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody,clone OTI12G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ASS1 mouse monoclonal antibody,clone OTI12G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated