Primary Antibodies

View as table Download

ICOSL / B7-H2 Mouse Monoclonal (2D3) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-ICOSLG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ICOSLG antibody is: synthetic peptide directed towards the N-terminal region of Human ICOSLG. Synthetic peptide located within the following region: VDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEV

Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ICOSLG mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-ICOSLG Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 70-84 amino acids of human inducible T-cell co-stimulator ligand

Rabbit Polyclonal Anti-ICOSLG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ICOSLG

ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications WB
Reactivities Human
Conjugation Unconjugated

ICOSLG mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications WB
Reactivities Human
Conjugation Unconjugated

ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications WB
Reactivities Human
Conjugation Unconjugated

ICOSLG mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications WB
Reactivities Human
Conjugation Unconjugated

ICOSLG (B7H2, CD275) mouse monoclonal antibody,clone UMAB254

Applications 10k-ChIP, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ICOSLG (B7H2, CD275) mouse monoclonal antibody,clone UMAB254

Applications 10k-ChIP, IHC, WB
Reactivities Human
Conjugation Unconjugated

ICOSLG (B7H2, CD275) mouse monoclonal antibody,clone UMAB254

Applications 10k-ChIP, IHC, WB
Reactivities Human
Conjugation Unconjugated