ICOS Ligand (ICOSLG) Rabbit Polyclonal Antibody

CAT#: TA343354

Rabbit Polyclonal Anti-ICOSLG Antibody

Product Images

WB Suggested Anti-ICOSLG Antibody; Titration: 1.0 ug/ml; Positive Control: ACHN Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ICOSLG antibody is: synthetic peptide directed towards the N-terminal region of Human ICOSLG. Synthetic peptide located within the following region: VDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: inducible T-cell costimulator ligand
• Database Link:
  NP_056074
  Entrez Gene 23308 Human
  UniProt ID O75144
• Background: ICOSLG is a ligand for the T-cell-specific cell surface receptor ICOS. ICOSLG acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. ICOSLG could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function.
• Synonyms: B7-H2; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Bovine: 92%; Horse: 85%; Guinea pig

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs)