Primary Antibodies

View as table Download

Rabbit Polyclonal ZBP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ZBP1 antibody was raised against a 18 amino acid peptide from near the carboxy terminus of human ZBP1.

Rabbit Polyclonal Z DNA binding protein Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-ZBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBP1 antibody: synthetic peptide directed towards the middle region of human ZBP1. Synthetic peptide located within the following region: LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG