Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to Deltex1 (deltex homolog 1 (Drosophila))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 343 and 617 of Deltex1 (Uniprot ID#Q86Y01)

Rabbit Polyclonal Anti-DTX1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DTX1 antibody: synthetic peptide directed towards the N terminal of human DTX1. Synthetic peptide located within the following region: SRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQ

Anti-DXT1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 50-64 amino acids of Human deltex homolog 1 (Drosophila)

Rabbit Polyclonal Anti-DTX1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DTX1