Rabbit Polyclonal Anti-HES5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HES5 antibody was raised against a 19 amino acid peptide near the amino terminus of human HES5. |
Rabbit Polyclonal Anti-HES5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HES5 antibody was raised against a 19 amino acid peptide near the amino terminus of human HES5. |
Rabbit Polyclonal Anti-Beclin 2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Beclin 2 antibody was raised against a 16 amino acid peptide near the amino terminus of human Beclin 2. |
Rabbit Polyclonal HES5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid1-50 of human HES5 was used as the immunogen for this antibody. |
Rabbit Polyclonal Anti-HES5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HES5 |
Rabbit Polyclonal Anti-HES5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HES5 antibody: synthetic peptide directed towards the middle region of human HES5. Synthetic peptide located within the following region: AASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAH |
Carrier-free (BSA/glycerol-free) HES5 mouse monoclonal antibody,clone OTI6F7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
HES5 mouse monoclonal antibody,clone OTI6F7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
HES5 mouse monoclonal antibody,clone OTI6F7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |