Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-HES5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen HES5 antibody was raised against a 19 amino acid peptide near the amino terminus of human HES5.

Rabbit Polyclonal Anti-Beclin 2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Beclin 2 antibody was raised against a 16 amino acid peptide near the amino terminus of human Beclin 2.

Rabbit Polyclonal HES5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A portion of amino acid1-50 of human HES5 was used as the immunogen for this antibody.

Rabbit Polyclonal Anti-HES5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HES5

Rabbit Polyclonal Anti-HES5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HES5 antibody: synthetic peptide directed towards the middle region of human HES5. Synthetic peptide located within the following region: AASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAH

Carrier-free (BSA/glycerol-free) HES5 mouse monoclonal antibody,clone OTI6F7

Applications WB
Reactivities Human
Conjugation Unconjugated

HES5 mouse monoclonal antibody,clone OTI6F7

Applications WB
Reactivities Human
Conjugation Unconjugated

HES5 mouse monoclonal antibody,clone OTI6F7

Applications WB
Reactivities Human
Conjugation Unconjugated