Primary Antibodies

Jump to Filters
View as table Download
FABP3 Mouse Monoclonal Antibody [Clone ID: 3E8-B10]
TA346940

USD 380.00

4 Weeks

Mouse Monoclonal H-FABP Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
FABP3 Mouse Monoclonal Antibody [Clone ID: 5C4-F5]
TA346942

USD 380.00

4 Weeks

Mouse Monoclonal H-FABP Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
FABP3 Mouse Monoclonal Antibody [Clone ID: 22]
4F29-22

USD 375.00

2 Weeks

FABP3 mouse monoclonal antibody, clone 22

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
FABP3 Mouse Monoclonal Antibody [Clone ID: 30]
4F29-30

USD 375.00

2 Weeks

FABP3 mouse monoclonal antibody, clone 30

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
FABP3 Mouse Monoclonal Antibody [Clone ID: 31]
4F29-31

USD 375.00

2 Weeks

FABP3 mouse monoclonal antibody, clone 31

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
FABP3 Rabbit Polyclonal Antibody
TA334289

USD 310.00

5 Days

Rabbit Polyclonal Anti-FABP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the N terminal of human FABP3. Synthetic peptide located within the following region: NGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHL
FABP3 Rabbit Polyclonal Antibody
TA342387

USD 375.00

5 Days

Rabbit Polyclonal Anti-FABP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV
FABP3 Rabbit Polyclonal Antibody
TA342388

USD 375.00

5 Days

Rabbit Polyclonal Anti-FABP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: DETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHG
FABP3 Mouse Monoclonal Antibody [Clone ID: 10E1]
4F29-10E1

USD 375.00

2 Weeks

FABP3 mouse monoclonal antibody, clone 10E1

Applications ELISA
Reactivities Human
Conjugation Unconjugated
FABP3 Mouse Monoclonal Antibody [Clone ID: 25]
4F29-25

USD 375.00

2 Weeks

FABP3 mouse monoclonal antibody, clone 25

Applications ELISA
Reactivities Human
Conjugation Unconjugated
FABP3 Mouse Monoclonal Antibody [Clone ID: 5B5]
4F29-5B5

USD 375.00

2 Weeks

FABP3 mouse monoclonal antibody, clone 5B5

Applications ELISA
Reactivities Human
Conjugation Unconjugated
FABP3 Mouse Monoclonal Antibody [Clone ID: 883CT19.3.3]
TA324943

USD 450.00

5 Days

Mouse monoclonal FAPB3 Antibody(Ascites)

Applications WB
Reactivities Mouse
Conjugation Unconjugated
FABP3 Rabbit Polyclonal Antibody
TA322796

USD 345.00

In Stock

Anti-FABP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 95-108 amino acids of Human Fatty acid-binding protein 3