Primary Antibodies

View as table Download

Rabbit polyclonal APG1 (ULK1) Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This APG1 (ULK1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-672 amino acids from the Central region of human APG1 (ULK1).

Rabbit Polyclonal ULK1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ULK1 antibody was raised against a 16 amino acid peptide near the center of human ULK1 .

Rabbit Polyclonal ULK1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids between 320 and 370 of human ULK1 was used as the immunogen, GenBank no. sp O75385.2 ULK1_HUMAN.

Rabbit Polyclonal Anti-ULK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ULK1 Antibody is: synthetic peptide directed towards the N-terminal region of Human ULK1. Synthetic peptide located within the following region: PEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTL