Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GATM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATM antibody: synthetic peptide directed towards the middle region of human GATM. Synthetic peptide located within the following region: PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN

Carrier-free (BSA/glycerol-free) GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated