Rabbit Polyclonal Anti-5-HT-1A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-5-HT-1A Antibody: A synthesized peptide derived from human 5-HT-1A |
Rabbit Polyclonal Anti-5-HT-1A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-5-HT-1A Antibody: A synthesized peptide derived from human 5-HT-1A |
Rabbit Polyclonal Anti-5-HT-1A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-5-HT-1A Antibody: A synthesized peptide derived from human 5-HT-1A |
Goat Anti-Htr1a Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ERKNERTAEAKRK, from the internal region of the protein sequence according to NP_032334.2. |
Rabbit polyclonal anti-5-HT-1A antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human 5-HT-1A. |
Rabbit Polyclonal Anti-HTR1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR1A antibody: synthetic peptide directed towards the N terminal of human HTR1A. Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC |
Rabbit Polyclonal Anti-HTR1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR1A antibody: synthetic peptide directed towards the N terminal of human HTR1A. Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC |
Anti-5HT1A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 140-153 amino acids of Human 5-hydroxytryptamine receptor 1A |
Anti-5HT1A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 140-153 amino acids of Human 5-hydroxytryptamine receptor 1A |
HTR1A Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human HTR1A |
Modifications | Unmodified |