5 HT1A (HTR1A) Rabbit Polyclonal Antibody

CAT#: TA330443

Rabbit Polyclonal Anti-HTR1A Antibody

Product Images

HTR1A antibody - N-terminal region validated by WB using primary cultured neurons

• 

  Host: Rabbit; Target Name: HTR1A; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: HTR1A; Sample Tissue: Jurkat; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:1.0ug/mL; Peptide Concentration: 1.0ug/mL; Lysate Quantity: 25ug/lane; Gel Concentration: 12%

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HTR1A antibody: synthetic peptide directed towards the N terminal of human HTR1A. Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: 5-hydroxytryptamine receptor 1A
• Database Link:
  NP_000515
  Entrez Gene 3350 Human
  UniProt ID P08908
• Background: This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibits adenylate cyclase activity.
• Synonyms: 5-HT-1A; 5-HT1A; 5HT1a; ADRB2RL1; ADRBRL1; G-21; PFMCD
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction