Rabbit polyclonal anti-PTPN22 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PTPN22. |
Rabbit polyclonal anti-PTPN22 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PTPN22. |
Rabbit Polyclonal Anti-PTPN22 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTPN22 Antibody: A synthesized peptide derived from human PTPN22 |
Rabbit Polyclonal Anti-PTPN22 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTPN22 antibody is: synthetic peptide directed towards the middle region of Human PTPN22. Synthetic peptide located within the following region: TAPRIDDEIPPPLPVWTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSL |
Carrier-free (BSA/glycerol-free) PTPN22 mouse monoclonal antibody,clone OTI6B1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PTPN22 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PTPN22 |
PTPN22 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PTPN22 |
PTPN22 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human PTPN22 (NP_036543.4). |
Modifications | Unmodified |
PTPN22 mouse monoclonal antibody,clone OTI6B1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PTPN22 mouse monoclonal antibody,clone OTI6B1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |