Primary Antibodies

Jump to Filters
View as table Download
SYNPR Rabbit Polyclonal Antibody
TA342623

USD 375.00

5 Days

Rabbit Polyclonal Anti-SYNPR Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Synpr antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV
SYNPR Rabbit Polyclonal Antibody
TA382248

USD 220.00

3 Weeks

SYNPR Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 196-265 of human SYNPR (NP_653243.1).
Modifications Unmodified