Rabbit Polyclonal Anti-MS4A4A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MS4A4A antibody: synthetic peptide directed towards the N terminal of human MS4A4A. Synthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL |
Ms4a4a Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human Ms4a4a. |
Recombinant Anti-MS4A4A (Clone 5C12)
| Applications | FC, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-MS4A4A (Clone 5C12)
| Applications | FC, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-MS4A4A (Clone 3F2)
| Applications | FC, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-MS4A4A (Clone 3F2)
| Applications | FC, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Germany
Japan
United Kingdom
China