Rabbit Polyclonal USP10 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | USP10 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human USP10. |
Rabbit Polyclonal USP10 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | USP10 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human USP10. |
Rabbit Polyclonal Anti-USP10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USP10 antibody: synthetic peptide directed towards the middle region of human USP10. Synthetic peptide located within the following region: GVELHTTESIDLDPTKPESASPPADGTGSASGTLPVSQPKSWASLFHDSK |
Carrier-free (BSA/glycerol-free) USP10 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) USP10 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) USP10 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Usp10 Antibody - C-terminal region
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
USP10 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human USP10 |
USP10 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 499-798 of human USP10 (NP_005144.2). |
Modifications | Unmodified |
USP10 Rabbit polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human USP10 |
USP10 Rabbit monoclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USP10 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USP10 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USP10 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
USP10 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
USP10 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USP10 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |