Primary Antibodies

View as table Download

CACNB4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CACNB4

Goat Polyclonal Antibody against CACNB4 (C terminus)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CSPGGYSHDSRHRL, from the C Terminus of the protein sequence according to NP_001005747.1; NP_000717.2; NP_001005746.1.

Goat Polyclonal Antibody against CACNB4 (internal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DYPDSYQDTYKPH, from the internal region (near the C Terminus) of the protein sequence according to NP_001005747.1; NP_000717.2; NP_001005746.1.

Mouse monoclonal CaVbeta4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-CACNB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the C terminal of human CACNB4. Synthetic peptide located within the following region: LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS

Rabbit Polyclonal Anti-CACNB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the middle region of human CACNB4. Synthetic peptide located within the following region: FDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRISSLAEVQSEIERIF

CACNB4 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CACNB4

CACNB4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 401-520 of human CACNB4 (NP_000717.2).
Modifications Unmodified