CACNB4 Rabbit Polyclonal Antibody

CAT#: TA341725

Rabbit Polyclonal Anti-CACNB4 Antibody

Product Images

WB Suggested Anti-CACNB4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: MCF7 cell lysate

• 

  Host: Rabbit; Target Name: CACNB2; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CACNB2; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CACNB2; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the middle region of human CACNB4. Synthetic peptide located within the following region: FDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRISSLAEVQSEIERIF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: calcium voltage-gated channel auxiliary subunit beta 4
• Database Link:
  NP_000717
  Entrez Gene 785 Human
  UniProt ID O00305
• Background: This gene encodes a member ofThe beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediateThe influx of calcium ions intoThe cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each ofThese subunits exist, either expressed from similar genes orThe result of alternative splicing.The protein encoded byThis locus plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controllingThe alpha-1 subunit membrane targeting and shiftingThe voltage dependence of activation and inactivation. Certain mutations inThis gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME). Multiple transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Mar 2009]
• Synonyms: CAB4; CACNLB4; EA5; EIG9; EJM; EJM4; EJM6
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other
• Protein Pathways: Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway