Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CSTF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSTF2 antibody: synthetic peptide directed towards the N terminal of human CSTF2. Synthetic peptide located within the following region: VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA

Rabbit polyclonal anti-CSTF2 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CSTF2.

Goat Anti-betaCstF-64 variant 1/ betaCstF-64 variant 3 (mouse) Antibody

Applications IP, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-PASIERVQGQRT, from the internal region of the protein sequence according to ACF05702.1; ACF05700.1.

Cstf2 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

CSTF2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human CSTF2 (NP_001316.1).
Modifications Unmodified