Cleavage stimulation factor 2 (CSTF2) Rabbit Polyclonal Antibody

CAT#: TA345769

Rabbit Polyclonal Anti-CSTF2 Antibody

Product Images

WB Suggested Anti-CSTF2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysate; CSTF2 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CSTF2 antibody: synthetic peptide directed towards the N terminal of human CSTF2. Synthetic peptide located within the following region: VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: cleavage stimulation factor subunit 2
• Database Link:
  NP_001316
  Entrez Gene 1478 Human
  UniProt ID P33240
• Background: CSTF2 is a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs.This gene encodes a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: CstF-64
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Rat: 93%; Pig: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%; Dog: 85%; Bovine: 85%