Rabbit Polyclonal Anti-HIC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIC2 antibody: synthetic peptide directed towards the C terminal of human HIC2. Synthetic peptide located within the following region: FACDECGMRFTRQYRLTEHMRVHSGEKPYECQLCGGKFTQQRNLISHLRM |
Rabbit Polyclonal Anti-HIC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIC2 antibody: synthetic peptide directed towards the N terminal of human HIC2. Synthetic peptide located within the following region: MVSGPLALRWCAWAGRGDMGPDMELPSHSKQLLLQLNQQRTKGFLCDVII |
Rabbit Polyclonal anti-HIC2 antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HIC2 antibody: synthetic peptide directed towards the middle region of human HIC2. Synthetic peptide located within the following region: CKEEEENGKDASEDSAQSGSEGGSGHASAHYMYRQEGYETVSYGDNLYVC |
Goat Anti-HIC2 (aa188-200) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PQELPQAKGSDDE, from the internal region of the protein sequence according to NP_055909.2. |
Rabbit Polyclonal Anti-HIC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HIC2 Antibody: synthetic peptide directed towards the middle region of human HIC2. Synthetic peptide located within the following region: KSPPLPPATPGPHLTPDDAAQLSDSQHGSPPAASAPPVANSASYSELGGT |
HIC2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HIC2 |
HIC2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-420 of human HIC2 (NP_055909.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
