Primary Antibodies

View as table Download

HOXD10 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXD10

HOXD10 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXD10

Rabbit Polyclonal HOXD10 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Goat Anti-HOXD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence PNRSCRIEQPVTQQ, from the internal region of the protein sequence according to NP_002139.2.

Rabbit Polyclonal Anti-HOXD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXD10 antibody: synthetic peptide directed towards the middle region of human HOXD10. Synthetic peptide located within the following region: NPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSA

Carrier-free (BSA/glycerol-free) HOXD10 mouse monoclonal antibody,clone OTI1D11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HOXD10 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HOXD10 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXD10

HOXD10 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXD10

HOXD10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human HOXD10 (NP_002139.2).
Modifications Unmodified

HOXD10 mouse monoclonal antibody,clone OTI1D11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HOXD10 mouse monoclonal antibody,clone OTI1D11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HOXD10 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HOXD10 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated