Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-POGZ Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POGZ antibody: synthetic peptide directed towards the N terminal of human POGZ. Synthetic peptide located within the following region: EELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHASVA

Rabbit Polyclonal Anti-POGZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POGZ antibody: synthetic peptide directed towards the C terminal of human POGZ. Synthetic peptide located within the following region: ASLEEQLKLSGEHSESSTPRPRSSPEETIEPESLHQLFEGESETESFYGF

Rabbit polyclonal anti-Pogz antibody

Applications WB
Reactivities Human, Dog, Short-tailed Opossum, Bovine, Rat, Chimpanzee, Macaque, Olive Baboon, Chicken
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of mouse Pogz protein.

Rabbit Polyclonal Anti-POGZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-POGZ Antibody: synthetic peptide directed towards the middle region of human POGZ. Synthetic peptide located within the following region: STMPVRPTTNTFTTVIPATLTIRSTVPQSQSQQTKSTPSTSTTPTATQPT