PRMT5 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PRMT5 |
PRMT5 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PRMT5 |
Rabbit Polyclonal Anti-PRMT5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRMT5 antibody: synthetic peptide directed towards the N terminal of human PRMT5. Synthetic peptide located within the following region: FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS |
Goat Anti-PRMT5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RACREKDRDPEAQ, from the internal region of the protein sequence according to NP_006100.2; NP_001034708.1. |
Rabbit polyclonal anti-PRMT-5 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 51 of rat PRMT-5 |
Carrier-free (BSA/glycerol-free) PRMT5 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRMT5 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRMT5 mouse monoclonal antibody, clone OTI1F8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRMT5 mouse monoclonal antibody, clone OTI3E6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRMT5 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PRMT5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 622-637 amino acids of human protein arginine methyltransferase 5 |
PRMT5 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human PRMT5 (NP_006100.2). |
Modifications | Unmodified |
Recombinant Anti-PRMT5 (Clone RAB-C136)
Applications | ChIP, ELISA, IF |
Reactivities | Human |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. |
PRMT5 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRMT5 mouse monoclonal antibody, clone OTI4G7 (formerly 4G7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRMT5 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRMT5 mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRMT5 mouse monoclonal antibody,clone OTI1F8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRMT5 mouse monoclonal antibody,clone OTI1F8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRMT5 mouse monoclonal antibody,clone OTI3E6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRMT5 mouse monoclonal antibody,clone OTI3E6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRMT5 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRMT5 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |