Rabbit Polyclonal VMAT2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human VMAT2 protein (within residues 30-200). [Swiss-Prot Q05940] |
Rabbit Polyclonal VMAT2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human VMAT2 protein (within residues 30-200). [Swiss-Prot Q05940] |
Slc18a2 (496-515) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SLC18A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC18A2 Antibody: synthetic peptide directed towards the N terminal of human SLC18A2. Synthetic peptide located within the following region: NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT |
Sheep Anti-Vesicular Monoamine Transporter 2, C-terminus (VMAT2) Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues from the intracellular C-terminal region conjugated to KLH |
Carrier-free (BSA/glycerol-free) SLC18A2 mouse monoclonal antibody, clone OTI10C11 (formerly 10C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SLC18A2 mouse monoclonal antibody, clone OTI9E11 (formerly 9E11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SLC18A2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 500-514 amino acids of human solute carrier family 18 (vesicular monoamine), member 2 |
Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI10C11 (formerly 10C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI10C11 (formerly 10C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI9E11 (formerly 9E11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI9E11 (formerly 9E11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |