Rabbit Polyclonal Anti-TLK2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLK2 antibody: synthetic peptide directed towards the N terminal of human TLK2. Synthetic peptide located within the following region: VSAQQNSPSSTGSGNTEHSCSSQKQISIQHRQTQSDLTIEKISALENSKN |
Rabbit Polyclonal Anti-TLK2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLK2 antibody: synthetic peptide directed towards the N terminal of human TLK2. Synthetic peptide located within the following region: SNQSLCSVGSLSDKEVETPEKKQNDQRNRKRKAEPYETSQGKGTPRGHKI |
TLK2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human TLK2 (NP_006843.2). |
| Modifications | Unmodified |
TLK2 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TLK2 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
