Primary Antibodies

Jump to Filters
View as table Download
EGFR Rabbit Polyclonal Antibody
TA328294

USD 285.00

5 Days

Anti-Human EGF Receptor Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen CHO cells derived Recombinant Human EGF Receptor (EGFR)
LEF1 Rabbit Polyclonal Antibody
TA330116

USD 375.00

5 Days

Rabbit Polyclonal Anti-LEF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the N terminal of human LEF1. Synthetic peptide located within the following region: VARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMN
LEF1 Rabbit Polyclonal Antibody
TA330287

USD 375.00

5 Days

Rabbit Polyclonal Anti-LEF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the middle region of human LEF1. Synthetic peptide located within the following region: ADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGG
EGFR Rabbit Polyclonal Antibody
TA354217

USD 355.00

5 Days

Rabbit anti EGFR Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
EGFR Rabbit Polyclonal Antibody
TA354481

USD 335.00

5 Days

Rabbit anti EGFR(pY1173) Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
EGFR Rabbit Polyclonal Antibody
TA354691

USD 350.00

5 Days

Rabbit anti EGFR(pS1070) Polyclonal Antibody

Reactivities Human, Mouse
Conjugation Unconjugated
EGFR Rabbit Polyclonal Antibody
TA354965

USD 345.00

5 Days

Rabbit anti EGFR(pY1092) Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated