LEF1 Rabbit Polyclonal Antibody

CAT#: TA330287

Rabbit Polyclonal Anti-LEF1 Antibody

Product Images

WB Suggested Anti-LEF1 Antibody Titration: 0.1-2.0ug/ml; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: LEF1; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the middle region of human LEF1. Synthetic peptide located within the following region: ADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: lymphoid enhancer binding factor 1
• Database Link:
  NP_057353
  Entrez Gene 51176 Human
  UniProt ID Q9UJU2
• Background: Lymphoid enhancer-binding factor-1 (LEF1) is a 48-kD nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1).
• Synonyms: LEF-1; TCF1ALPHA; TCF7L3; TCF10
• Note: Immunogen sequence homology: Dog: 100%; Goat: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 86%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: Acute myeloid leukemia, Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Basal cell carcinoma, Colorectal cancer, Endometrial cancer, Melanogenesis, Pathways in cancer, Prostate cancer, Thyroid cancer, Wnt signaling pathway