Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to TCP1 beta (chaperonin containing TCP1, subunit 2 (beta))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 277 and 503 of TCP1 beta (Uniprot ID#P78371)

Rabbit Polyclonal Anti-CCT2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCT2 antibody is: synthetic peptide directed towards the middle region of CCT2. Synthetic peptide located within the following region: RVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGA