Rabbit anti-FKBP4 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FKBP4 |
Rabbit anti-FKBP4 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FKBP4 |
Rabbit Polyclonal antibody to FKBP52 (FK506 binding protein 4, 59kDa)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 207 of FKBP52 (Uniprot ID#Q02790) |
Rabbit Polyclonal anti-FKBP4 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FKBP4 antibody: synthetic peptide directed towards the C terminal of human FKBP4. Synthetic peptide located within the following region: ANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA |
Goat Anti-FKBP4 / FKBP52 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DHPTDTEMKEEQKSN, from the CTerminus of the protein sequence according to NP_002005.1. |