FKBP52 (FKBP4) Rabbit Polyclonal Antibody

CAT#: TA329129

Rabbit Polyclonal anti-FKBP4 antibody

Product Images

Host: Rabbit; Target Name: FKBP4; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

• 

  WB Suggested Anti-FKBP4 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysateFKBP4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• 

  Sample Type: Mouse Brain Slices ; Red: primary; Blue: DAPI; Primary; Dilution: 1:400 ; Secondary Antibody: Anti-Rabbit IgG Alexa 594; Secondary; Dilution: 1:400 ; Image Submitted By: Adahir Labrador-Garrido and Cintia Roodveldt ; University of Seville; ;

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FKBP4 antibody: synthetic peptide directed towards the C terminal of human FKBP4. Synthetic peptide located within the following region: ANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: FK506 binding protein 4
• Database Link:
  NP_002005
  Entrez Gene 2288 Human
  UniProt ID Q02790
• Background: FKBP4 is a component of unactivated mammalian steroid receptor complexes that sediment at 8-10 S. It may have a rotamase activity. FKBP4 may play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It has high structural and functional similarity to FK506-binding protein 1A (FKBP1A), but unlike FKBP1A, this protein does not have immunosuppressant activity when complexed with FK506. It interacts with interferon regulatory factor-4 and plays an important role in immunoregulatory gene expression in B and T lymphocytes. This encoded protein is known to associate with phytanoyl-CoA alpha-hydroxylase. It can also associate with two heat shock proteins (hsp90 and hsp70) and thus may play a role in the intracellular trafficking of hetero-oligomeric forms of the steroid hormone receptors. This protein correlates strongly with adeno-associated virus type 2 vectors (AAV) resulting in a significant increase in AAV-mediated transgene expression in human cell lines. Thus this encoded protein is thought to have important implications for the optimal use of AAV vectors in human gene therapy. This gene has been found to have multiple polyadenylation sites. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: FKBP51; FKBP52; FKBP59; HBI; Hsp56; p52; PPIase
• Note: Immunogen sequence homology: Human: 100%; Pig: 75%

Reference Data

• Protein Families: Druggable Genome