Primary Antibodies

Jump to Filters
View as table Download
PRMT3 Rabbit Polyclonal Antibody
TA345674

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRMT3 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3. Synthetic peptide located within the following region: LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK
PRMT3 Rabbit Polyclonal Antibody
TA329912

USD 375.00

5 Days

Rabbit Polyclonal Anti-PRMT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3. Synthetic peptide located within the following region: FSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILS
PRMT3 Rabbit Polyclonal Antibody
TA322557

USD 345.00

In Stock

Anti-PRMT3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 9-23 amino acids of Human protein arginine methyltransferase 3