Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-TCF12 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF12 antibody: synthetic peptide directed towards the N terminal of human TCF12. Synthetic peptide located within the following region: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDE |
Rabbit Polyclonal Anti-TCF12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF12 antibody: synthetic peptide directed towards the middle region of human TCF12. Synthetic peptide located within the following region: GGLQSQSGTVVTTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSS |
Rabbit Polyclonal Anti-TCF12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF12 antibody: synthetic peptide directed towards the N terminal of human TCF12. Synthetic peptide located within the following region: IGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSW |
Rabbit Polyclonal Anti-TCF12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF12 antibody is: synthetic peptide directed towards the C-terminal region of Human TCF12. Synthetic peptide located within the following region: AVILSLEQQVRERNLNPKAACLKRREEEKVSAVSAEPPTTLPGTHPGLSE |
Active filters
Target Symbol
- TCF12
Isotypes
- IgG
Families
- Druggable Genome