Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-IL5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL5 Antibody: synthetic peptide directed towards the middle region of human IL5. Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL |
Rabbit Polyclonal Anti-IL9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL9 Antibody: synthetic peptide directed towards the middle region of human IL9. Synthetic peptide located within the following region: SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT |
Rabbit Polyclonal Anti-IL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC |
Rabbit Polyclonal Anti-IL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS |
Mouse Monoclonal Anti-IL-4 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Human, Rhesus Macaque |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-10 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-13 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-TNF-alpha Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-TNF-alpha Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IL-10 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | For immunization recombinant human IL-10 (E.coli-derived) is used |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Rhesus Macaque, Cynomolgus Monkey, Human |
| Conjugation | Unconjugated |
Rabbit anti CD154 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to aa 51-69 of human CD154. |
Rabbit anti CD40 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse anti IL-4 Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti IL-10 Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti TNF alpha Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti Eotaxin Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) anti-IL-3 mouse monoclonal antibody, clone OTI5G7H9 (formerly 5G7H9)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) IL13 mouse monoclonal antibody, clone OTI6D3 (formerly 6D3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Purified CCL11 mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI7H2 (formerly 7H2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI8C5 (formerly 8C5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI6C12 (formerly 6C12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI7F6 (formerly 7F6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Families
- Druggable Genome
Pathways
- Asthma