Primary Antibodies

View as table Download

USD 320.00

In Stock

Goat Polyclonal Anti-CANX Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli.

USD 320.00

In Stock

Goat Polyclonal Anti-CANX Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli.

USD 450.00

In Stock

Goat Polyclonal Anti-CANX Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli.

Goat Anti-Calnexin Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-SKTPELNLDQFHDKT, from the internal region (near N-Terminus) of the protein sequence according to NP_001737.1.

USD 450.00

5 Days

Goat Polyclonal Anti-CANX Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli.

Rabbit Polyclonal Calnexin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the rat Calnexin protein (between residues 550-591) [UniProt P35565]

Rabbit Polyclonal Calnexin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643]

Rabbit Polyclonal anti-CANX Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus
Conjugation Unconjugated
Immunogen A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH.

Rabbit Polyclonal anti-CANX Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus
Conjugation Unconjugated
Immunogen A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH.

Rabbit Polyclonal anti-CANX Antibody

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus
Conjugation Unconjugated
Immunogen Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Rabbit Polyclonal anti-CANX Antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus
Conjugation Unconjugated
Immunogen Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Rabbit Polyclonal Anti-Calnexin -CT Antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken (weak), Dog, Guinea pig, Hamster, Pig, Quail, Rabbit, Sheep, Drosophila (weak), Xenopus (weak)
Conjugation Unconjugated
Immunogen Dog Calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Rabbit Polyclonal Anti-CANX Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CANX antibody: synthetic peptide directed towards the C terminal of human CANX. Synthetic peptide located within the following region: RPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEE

Rabbit Polyclonal Anti-CANX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CANX antibody: synthetic peptide directed towards the middle region of human CANX. Synthetic peptide located within the following region: LVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK

Rabbit Polyclonal Anti-CANX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CANX