Calnexin (CANX) Rabbit Polyclonal Antibody

CAT#: TA342726

Rabbit Polyclonal Anti-CANX Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CANX"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CANX antibody: synthetic peptide directed towards the C terminal of human CANX. Synthetic peptide located within the following region: RPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 65 kDa
Gene Name calnexin
Background This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding the same protein have been described.
Synonyms CNX; IP90; P90
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 93%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Antigen processing and presentation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.