Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CD226/DNAM-1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CD226/DNAM-1 Antibody: A synthesized peptide derived from human CD226/DNAM-1

Rabbit polyclonal CD226/DNAM-1 (Ab-329) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CD226/DNAM-1 around the phosphorylation site of serine 329 (T-F-SP-R-R).

Rabbit Polyclonal Anti-CD226 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD226 antibody is: synthetic peptide directed towards the C-terminal region of Human CD226. Synthetic peptide located within the following region: QASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIF

Rabbit Polyclonal Anti-CD226 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CD226

CD226 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated