CD226 Rabbit Polyclonal Antibody

CAT#: TA343331

Rabbit Polyclonal Anti-CD226 Antibody

Product Images

Host: Rabbit; Target Name: CD226; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CD226 antibody is: synthetic peptide directed towards the C-terminal region of Human CD226. Synthetic peptide located within the following region: QASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: CD226 molecule
• Database Link:
  NP_006557
  Entrez Gene 10666 Human
  UniProt ID Q15762
• Background: This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation.
• Synonyms: DNAM-1; DNAM1; PTA1; TLiSA1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 85%; Rat

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs)