Rabbit Polyclonal Kif2a Antibody
Reactivities | Human, Mammalian, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Produced by immunizing rabbits with a recombinant segment of the N-terminal domain of the human protein. |
Rabbit Polyclonal Kif2a Antibody
Reactivities | Human, Mammalian, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Produced by immunizing rabbits with a recombinant segment of the N-terminal domain of the human protein. |
Rabbit Polyclonal Anti-KIF2A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KIF2A antibody: synthetic peptide directed towards the middle region of human KIF2A. Synthetic peptide located within the following region: DSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL |
Rabbit Polyclonal Anti-KIF2A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KIF2A antibody: synthetic peptide directed towards the N terminal of human KIF2A. Synthetic peptide located within the following region: IEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPS |
Rabbit Polyclonal Anti-KIF2A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KIF2A antibody: synthetic peptide directed towards the C terminal of human KIF2A. Synthetic peptide located within the following region: ETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVED |
Rabbit Polyclonal Anti-KIF2A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KIF2A |